NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DelMOWin2010_c10044484

Scaffold DelMOWin2010_c10044484


Overview

Basic Information
Taxon OID3300000117 Open in IMG/M
Scaffold IDDelMOWin2010_c10044484 Open in IMG/M
Source Dataset NameMarine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2015
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location NameMicrobial Observatory off the coast of Delaware, USA
CoordinatesLat. (o)38.84917Long. (o)-75.1076Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037202Metagenome / Metatranscriptome168N
F059882Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
DelMOWin2010_100444842F059882GGAGGMNNVEILYQECKVCGKTFKLPTRKELEKSILFKASEVLGIDMGNGYTGGNSLLAMLNCSVECARKLENKE*
DelMOWin2010_100444843F037202GGAMNNIEDIKNKWENTRLLEELPEDEQYSMSQLLENEARHILSTYKDVNESQLANICFPLIRRIFQSSGFFEEGDCPLTFTYETSVVPAFTYFKPDEEESSVATTQVYDFDFQMSIEEVEKIRNNGHNAIDGEVELTSILSEAFRNELNEKHKGKHLVFGYPIMMREEDGERIYSYRCAVLPRGSRLHEGGYKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.