Scaffold TDF_OR_ARG04_113mDRAFT_c1012038

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TDF_OR_ARG04_113mDRAFT_c1012038

Scaffold TDF_OR_ARG04_113mDRAFT_c1012038

Overview

Basic Information
Taxon OID	3300000121 Open in IMG/M
Scaffold ID	TDF_OR_ARG04_113mDRAFT_c1012038 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1066
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	MC site, Ushuaia Bay, Tierra del Fuego, Argentina
Coordinates	Lat. (^o)	-54.810872	Long. (^o)	-68.295525	Alt. (m)		Depth (m)	11.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047764	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG04_113mDRAFT_10120383	F047764	N/A	MLKLKFNQNFKTIQLINQKQIKINIFKNYILINNKDFEDIIKIIESQYLKYKIIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.