NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KGI_S2_ANT06_2345mDRAFT_c1011877

Scaffold KGI_S2_ANT06_2345mDRAFT_c1011877


Overview

Basic Information
Taxon OID3300000123 Open in IMG/M
Scaffold IDKGI_S2_ANT06_2345mDRAFT_c1011877 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 06_23.45m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2555
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameS2 site, Potter Cove, King George Island, Antarctic Peninsula
CoordinatesLat. (o)-62.231932Long. (o)-58.655087Alt. (m)Depth (m)23.45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093886Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
KGI_S2_ANT06_2345mDRAFT_10118774F093886GAGGMNYWILIPIPIFLLIAAADIKAHNLVTVNSNARVHQHVYRRQQYGTPLQQGHLNRAPGGSSMITWRTGTRSDYGKLNARRDGPIIGDQRRKAGEIPKHTKKYGSAVKAYGKPRRDY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.