NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BS_KBA_SWE12_21mDRAFT_c10002135

Scaffold BS_KBA_SWE12_21mDRAFT_c10002135


Overview

Basic Information
Taxon OID3300000124 Open in IMG/M
Scaffold IDBS_KBA_SWE12_21mDRAFT_c10002135 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)7184
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (15.38%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameKBA site, Vaertahamnen, Baltic Sea, Sweden
CoordinatesLat. (o)59.363333Long. (o)18.119167Alt. (m)Depth (m)21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038081Metagenome166N
F069688Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
BS_KBA_SWE12_21mDRAFT_100021354F038081N/AMIFNKEEIKNILNMLLSEDKENTVIAFSCIDNYASKKHLGELLVLYQFGRTAAEEWEKECKKGFKLIKNVLKLDSTDYRLPSSTVFSALMDNKCSEESIELYLELFTNQLSNNLYNMGYPTDKLEINVKIKDNE*
BS_KBA_SWE12_21mDRAFT_100021357F069688N/AMEKINNIFTVDSVIEEDSYIKVTGKYLIPEGLPFERGNILTEDKYNGHQIYVAFATKDENEKDGLTLDTKSMHPSIKKSLDKIITGLHLFKIED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.