NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SA_S1_NOR08_45mDRAFT_c10008601

Scaffold SA_S1_NOR08_45mDRAFT_c10008601


Overview

Basic Information
Taxon OID3300000128 Open in IMG/M
Scaffold IDSA_S1_NOR08_45mDRAFT_c10008601 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4700
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameNorway: Adventfjord, Svalbard Archipelago
CoordinatesLat. (o)78.237209Long. (o)15.677776Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066233Metagenome / Metatranscriptome127N
F080617Metagenome / Metatranscriptome115N
F099229Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
SA_S1_NOR08_45mDRAFT_100086011F066233N/AMEIEKNIDDELKADAQEKGEIATKILDALVFSKFGGINYSMMIRRQRQNSYSSPRANPIYFEFDVDIDVDKTFEPSPTFDKAYEDYIYEIGDHIEKALRYVNLHDYMEEPMFTYVNDDLVENEVDRLENKLVLYLQSQYEGLSYDSIREADIGYYFYKGETDNPYMRIEYIGHPPIIDGD
SA_S1_NOR08_45mDRAFT_100086012F099229N/AMVMDNDIEKIVEIGKVLLNTPTLRSIYKDKFDINTIDFEFVEKTNSSQFTTNHEHYIFKVTLYTDISLNFDDRIKSGEIEGYDTIENELWEYGIDPFYLADIIIPEKILNIILPKGKGEPKVAIELLIIGDEGQVIWNDHMFGRPGFTN*
SA_S1_NOR08_45mDRAFT_100086013F080617N/AMSDNKLKWSLEKLFNTVGRNLAMNYYGFDSEYEVLSVIDEKTGEEVTDSDLGGTENYTATVKSKEPLPEIFDVKIEPLFRYGKYAQPMDLQFNLENLTKYISPNQIAVQLVGPEWKSGENTYRTLQSFEDKWGRSLDRNANDFKVNPDNWIELNNGSVVDKITGDSFPLMFNGLIDKTEVWNIARVDDDEWWDSLSDLDKERLSDNFS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.