NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug09P16500mDRAFT_c1014752

Scaffold LPaug09P16500mDRAFT_c1014752


Overview

Basic Information
Taxon OID3300000142 Open in IMG/M
Scaffold IDLPaug09P16500mDRAFT_c1014752 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1411
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP16, Pacific Ocean
CoordinatesLat. (o)49.283333Long. (o)-134.666667Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001066Metagenome / Metatranscriptome788Y

Sequences

Protein IDFamilyRBSSequence
LPaug09P16500mDRAFT_10147521F001066N/ACYIMADDLFKIKPIGGKNIVVEDKRKTVSPFNSAKHFKDANIPAYCDQCMYRSVDSGGNGKCPKYEKGAVCSIRDDYIKIINTLDTRKPDDVKAMLDMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLAVIKSINDLNTKIVVTQQTELDEKTGDISSIFKQIKAQGVSGDVR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.