NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug09P1610mDRAFT_c1005639

Scaffold LPaug09P1610mDRAFT_c1005639


Overview

Basic Information
Taxon OID3300000149 Open in IMG/M
Scaffold IDLPaug09P1610mDRAFT_c1005639 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1862
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP16, Pacific Ocean
CoordinatesLat. (o)49.283333Long. (o)-134.666667Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062906Metagenome130N

Sequences

Protein IDFamilyRBSSequence
LPaug09P1610mDRAFT_10056392F062906GAGMADINLRLLYLMDNPHGGNSVKVGSSGLAKYPTRIGNYQQGNGPDYLVTWPICYIGEETIINRLEERIKDSLEHDRLESRLGEWYDNHTAKTIAPKIDEIIQGNHFKVKKVNEKFLPIEYEIGWKTQKKMLEHYQKSHILSEFLVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.