NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_c0712086

Scaffold NODE_c0712086


Overview

Basic Information
Taxon OID3300000156 Open in IMG/M
Scaffold IDNODE_c0712086 Open in IMG/M
Source Dataset NameSugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAmbry Genetics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4850
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic

Source Dataset Sampling Location
Location NameSao Carlos, Brazil
CoordinatesLat. (o)-22.080556Long. (o)-48.997778Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004085Metagenome / Metatranscriptome454Y
F004998Metagenome / Metatranscriptome415Y
F010347Metagenome / Metatranscriptome305Y

Sequences

Protein IDFamilyRBSSequence
NODE_07120862F004998AGGAGGMIGRILVSLIAFALAGFLLLVLIGLWDGYEQETKALGFSGIYERHLASQAGFADDAKAYRAVVEAESARTAVVAETAAIEE*
NODE_07120865F010347GAGGMNERDFPHLVELELPPGGLPSQNLEFDAFHREHGIPIRRGRGRHEAEQFHVRFCFADAVTADAFHQRFGGTRLTYSPFKPGRPTGPRARYQPSYSPRVVDGKIMTPADLRRLHKYMLEIENVTVISDEMRAVVESEWPDLAHKLPLAKPQP*
NODE_07120867F004085GGGGGMGKILFSLAFATALLALASSEASAFLYSSFVCQAVGARSVGWGRSFFIGEAKVIALSRCARHSGICTISYCVPGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.