Scaffold LPjun09P1210mDRAFT_c1004452

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LPjun09P1210mDRAFT_c1004452

Scaffold LPjun09P1210mDRAFT_c1004452

Overview

Basic Information
Taxon OID	3300000168 Open in IMG/M
Scaffold ID	LPjun09P1210mDRAFT_c1004452 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1254
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	P12, Pacific Ocean
Coordinates	Lat. (^o)	48.97	Long. (^o)	-130.666667	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004191	Metagenome / Metatranscriptome	449	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun09P1210mDRAFT_10044526	F004191	N/A	GECLMNKFKEIMATWFAVLGIFAIVGSVGAVETDQWMLAFTLFVIGTSTMFISIVCQEKQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.