Scaffold TB18AUG2009E_c010117

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TB18AUG2009E_c010117

Scaffold TB18AUG2009E_c010117

Overview

Basic Information
Taxon OID	3300000203 Open in IMG/M
Scaffold ID	TB18AUG2009E_c010117 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1193
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.0412	Long. (^o)	-89.6864	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005200	Metagenome	408	Y

Sequences

Protein ID	Family	RBS	Sequence
TB18AUG2009E_0101172	F005200	GAGG	LDPITIFAACKAAHAGIRECIDLYQDFKKDGKDVSDIVQDVGQHLGAFFTHQEAFKEAEKEAKKKPLAKNISINEEAMNRILRQQQLEQMETDLREMIIYQIGMPGLWSKFVEMREVVRKEREKVEREQKKPLRKLPERDGSLSTNGKFVERYWLAVYLS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.