NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPjun09P12500mDRAFT_1025578

Scaffold LPjun09P12500mDRAFT_1025578


Overview

Basic Information
Taxon OID3300000222 Open in IMG/M
Scaffold IDLPjun09P12500mDRAFT_1025578 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1120
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP12, Pacific Ocean
CoordinatesLat. (o)48.97Long. (o)-130.666667Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063595Metagenome129N

Sequences

Protein IDFamilyRBSSequence
LPjun09P12500mDRAFT_10255781F063595N/AIIFCITDPSRLSSPFKLPITTWQAADKNAFIEIDDGGKRYKRSHGIPSAKFDFYKLQEAIKHYYRMLYDDSHMETMHRGLLREIDAVIKQYNKKCILLKCFTESFPDYTPENVVWGNLHLYEDISMKEFEHMSKKELKEIHKGKDERKNHLGNKNNYNMYLFLKDIIDKDDFTPREIKMEKYFE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.