Scaffold TB_LI09_4DRAFT_10214576

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TB_LI09_4DRAFT_10214576

Scaffold TB_LI09_4DRAFT_10214576

Overview

Basic Information
Taxon OID	3300000231 Open in IMG/M
Scaffold ID	TB_LI09_4DRAFT_10214576 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	623
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location Name	Lago Infinito, wall in 6.8 m depth, Frasassi Caves, Italy
Coordinates	Lat. (^o)	43.383333	Long. (^o)	12.95	Alt. (m)		Depth (m)	6.8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061534	Metagenome / Metatranscriptome	131	N

Sequences

Protein ID	Family	RBS	Sequence
TB_LI09_4DRAFT_102145761	F061534	GGGGG	MNDYGHXPPELMERVRGMFLTLFGGKEKLDCWLTRIADELADAGNPANRPIMLDPSLITEEFQSVMHRPKEVVDLILEKLDSLAVFGYTAKVVKQGEVSLAIVSDQASGHVIEEVAGPHPDNLILSLVEKYGINFEVVKE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.