NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TB_PC08_3DRAFT_1019398

Scaffold TB_PC08_3DRAFT_1019398


Overview

Basic Information
Taxon OID3300000235 Open in IMG/M
Scaffold IDTB_PC08_3DRAFT_1019398 Open in IMG/M
Source Dataset NameGroundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2036
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location NamePozzo dei Cristalli, Frasassi Caves, Italy
CoordinatesLat. (o)43.383333Long. (o)12.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031400Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
TB_PC08_3DRAFT_10193985F031400N/AMKLYKKYSLFLESKNNVKTKKNIVRDLCVSMLLINNTFLDNILDRGLAARYQENSQVFLTDLKNLLIAKNRLKIGKFEGNKCIEDDNLSLVNSVFDGVKFDIEKDWNELVNARTISRNIIDKLVPNKKLESDDIKSIYWNLDLDDDHQEDIVVELRDGQQFSFFLNKNLSSSKSTSFNTFAEDLIGQDLDLLFTEEYLVKWDKLTQEWIRILYDNANKDIQFHIEKFIDPKRIDSIGYFDYFDIRHGDLKYKHLGEFFKVFDKNILKFSELLLEIWKNRDNCFMD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.