 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000239 Open in IMG/M |
| Scaffold ID | SI36aug09_120mDRAFT_1010817 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2561 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saanich Inlet 36, Vancouver Island, BC, Canada | |||||||
| Coordinates | Lat. (o) | 48.5663346 | Long. (o) | -123.5193257 | Alt. (m) | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011190 | Metagenome / Metatranscriptome | 294 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SI36aug09_120mDRAFT_10108171 | F011190 | N/A | ITYMCELIMNFFRNLKKSFDGKDRLRNINQCMTCGKPSFFNSCLKCETSDAYEGWEKK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |