Scaffold SI34jun09_100mDRAFT_1000643

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SI34jun09_100mDRAFT_1000643

Scaffold SI34jun09_100mDRAFT_1000643

Overview

Basic Information
Taxon OID	3300000254 Open in IMG/M
Scaffold ID	SI34jun09_100mDRAFT_1000643 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	13840
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet 34, Vancouver Island, BC, Canada
Coordinates	Lat. (^o)	48.6	Long. (^o)	-123.5	Alt. (m)		Depth (m)	100
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032446	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
SI34jun09_100mDRAFT_10006436	F032446	AGGAG	MMSPKTIERVKWLATFMFVCAGTLISLNLPQSKYAFPLFASGHLIAIYVFTVLKDKPLIVQNYFFLCIDLIGIYQWLLKPIFFV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.