NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LP_A_09_P04_10DRAFT_1011505

Scaffold LP_A_09_P04_10DRAFT_1011505


Overview

Basic Information
Taxon OID3300000265 Open in IMG/M
Scaffold IDLP_A_09_P04_10DRAFT_1011505 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1887
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameLine P, Station P4
CoordinatesLat. (o)48.65Long. (o)-126.666667Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067102Metagenome / Metatranscriptome126Y
F101002Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
LP_A_09_P04_10DRAFT_10115051F067102N/AMEFKLEISRTNLANSYYEVDLFPEQQLEYDLDFYDSVEIDKVKLPFYTKLRIPLTTNNKASNRFNFEPITSPALEFPKEDFYFKITVFGSSSTEIAGILNVVSFEYNSAQSYIEVELKDYLSKYLAAMNGLKLGTLYGDSTAYYRNRHTFSDFLNTTANNGEAGVIGQNPDYTRPISFPYVDFCNDVDGKFGYAARQFLEYGPGLNRTGIMPVFSVPRFLEYIGQYLNSAAFPVRVDSKLFALGQYAANPAFPDFQAEKLHMIVPSQLLAKQDVNRRSFTVRQSPAWAGTNK
LP_A_09_P04_10DRAFT_10115052F101002N/AMADLVFRKFTQGTDPQYNGIAFLKSSDNVVRATAGAIGAVGNRDVVKIVYTDVYEKAIYGVCTDFNTGEITFDKDIYPVELTNFSGTVFKYNNTDIYETSVYRIGVDVENGLYSKAYNQYASNISYSLIIPTKRDEYFGGASSVITSPDVAFADLCDSKAYGVGLSDISLDTLNNKFKSSLEFNIATR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.