NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M3P_10227924

Scaffold M3P_10227924


Overview

Basic Information
Taxon OID3300000268 Open in IMG/M
Scaffold IDM3P_10227924 Open in IMG/M
Source Dataset NameLotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)541
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota

Source Dataset Sampling Location
Location NameUSA: Solway, Minnesota
CoordinatesLat. (o)47.349634Long. (o)-95.182806Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011390Metagenome291Y

Sequences

Protein IDFamilyRBSSequence
M3P_102279241F011390N/AMEIKTTNYGVCKVKKHKYQNNGNLALSLVDETGQPVVNITTNVFPMGENEFCANYFNMGATLWNDIASSGLFEQTGESVPSGYCEYPVCKLIVDIE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.