NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EM209_1020839

Scaffold EM209_1020839


Overview

Basic Information
Taxon OID3300000278 Open in IMG/M
Scaffold IDEM209_1020839 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Cork, Ireland - EM209
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Macrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)610
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location
Location NameCork, Ireland
CoordinatesLat. (o)51.907Long. (o)-8.472Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088914Metagenome109N

Sequences

Protein IDFamilyRBSSequence
EM209_10208391F088914N/AVGRILPVCSGFFVFWSRKEGANYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDSLFSVPYTPKENRKNPGKFIVFSAWYAAKALEMDVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.