Scaffold EM337_1034674

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold EM337_1034674

Scaffold EM337_1034674

Overview

Basic Information
Taxon OID	3300000296 Open in IMG/M
Scaffold ID	EM337_1034674 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Cork, Ireland - EM337
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI), Macrogen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	970
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location
Location Name	Cork, Ireland
Coordinates	Lat. (^o)	51.907	Long. (^o)	-8.472	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
EM337_10346742	F029444	N/A	MEVSEQLTGFELEDLMSWTVSNLQRPFREDFSLKKSGIIAEKESQIFGRRFAGFDGPKKAAPFFNF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.