Scaffold bgg_mtDRAFT_1032536

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold bgg_mtDRAFT_1032536

Scaffold bgg_mtDRAFT_1032536

Overview

Basic Information
Taxon OID	3300000305 Open in IMG/M
Scaffold ID	bgg_mtDRAFT_1032536 Open in IMG/M
Source Dataset Name	Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1638
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Blue Grama Grass Rhizosphere Eukaryotic And Microbial Communities From Sevilleta Long Term Ecological Research Site, New Mexico, Us

Source Dataset Sampling Location
Location Name	Sevilleta Long Term Ecological Research site, New Mexico, US
Coordinates	Lat. (^o)	34.3348	Long. (^o)	-106.631	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016972	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
bgg_mtDRAFT_10325361	F016972	N/A	VRLIPLTDEIPVVNLYLTIDDLYIFSLGAKTSRYGPYELGYRRATITLTI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.