Basic Information | |
---|---|
Taxon OID | 3300000329 Open in IMG/M |
Scaffold ID | EM172_1009757 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Cork, Ireland - EM172 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3021 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → environmental samples → Firmicutes bacterium CAG:321 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cork, Ireland | |||||||
Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068941 | Metagenome | 124 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
EM172_10097573 | F068941 | GAGG | MNNKKFIIGVVLLLLLMVGGTYAYYKWSSSDNVNVNVKIDGGTVTFNGGSNITSTIIPTASKEEGIKKDITVKASKAGVTMNLYMNLTTMPDELKENSFEYEIYYNSSTLVKKGNFGVYNSNTNTSGIAYATSGVTTLTLFTGRDVSTNSADKYTLYLWFNGKDYTNPNTMQSKKLSFDLYATGENAVLAGN* |
⦗Top⦘ |