Basic Information | |
---|---|
Taxon OID | 3300000346 Open in IMG/M |
Scaffold ID | BeoS_FeMat_6568CDRAFT_1000608 Open in IMG/M |
Source Dataset Name | Ferric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 10931 |
Total Scaffold Genes | 25 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 17 (68.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Beowulf Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.731451 | Long. (o) | -110.7113131 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018029 | Metagenome / Metatranscriptome | 237 | Y |
F075083 | Metagenome / Metatranscriptome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BeoS_FeMat_6568CDRAFT_100060823 | F075083 | GAGG | MNLEEIDLTEMPETESQKQKLIDSLRELDIDFEKGEDSVRIKGLAGFVCCGNIVVYQIPDRKIVFEELGDANRIILNSTDETKPGIKQILLDKSVYARYDFPYLIIQF* |
BeoS_FeMat_6568CDRAFT_10006086 | F018029 | AGG | MKYLWQVVMKKLQKDELNEKEMRDLIDYLNVLKEELKKLRIILYSPFGYIVDFNVVFKDPWYCSEVHLRLLNGEHGLLYLDSFIWRIFTNQIEVKPFISEVTHP* |
⦗Top⦘ |