NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BeoS_FeMat_6568CDRAFT_1001876

Scaffold BeoS_FeMat_6568CDRAFT_1001876


Overview

Basic Information
Taxon OID3300000346 Open in IMG/M
Scaffold IDBeoS_FeMat_6568CDRAFT_1001876 Open in IMG/M
Source Dataset NameFerric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4544
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameBeowulf Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.731451Long. (o)-110.7113131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006070Metagenome / Metatranscriptome382N
F040183Metagenome / Metatranscriptome162N

Sequences

Protein IDFamilyRBSSequence
BeoS_FeMat_6568CDRAFT_10018762F006070AGGMTLYRYLVVDLPIRDTNTHTYRTDPFDPLIPTQPGIGLVRLGESVPPVRAFNIYVYNFANVALNVQMIANENAKNYEYGNLLDGLNYFTEESYPDFNVGSAVTVPAGSLSAPSVETIQSDFYKDAAERYLSVALTYSATPTSGFVRAHIDLFYEGF*
BeoS_FeMat_6568CDRAFT_10018766F040183N/AMKLKYPFPQRFHYLTVLGKYLTPNTTIVASGANTGHLTANTVCDYVQTPNHKELAVNLTIQAVSGTSPSLTAYFDVLDPVEPQNVNVNSLERPPVLELKLNSTAITTAPTTIRLIIANGVATVWINGASTVLGYMNVPYIWQVRFAITGTSPSFSIVGTYEARE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.