Scaffold BeoS_FeMat_6568CDRAFT_1003771

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BeoS_FeMat_6568CDRAFT_1003771

Scaffold BeoS_FeMat_6568CDRAFT_1003771

Overview

Basic Information
Taxon OID	3300000346 Open in IMG/M
Scaffold ID	BeoS_FeMat_6568CDRAFT_1003771 Open in IMG/M
Source Dataset Name	Ferric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	2466
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 1 → Candidatus Marsarchaeota G1 archaeon OSP_D	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Beowulf Spring, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.731451	Long. (^o)	-110.7113131	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066922	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
BeoS_FeMat_6568CDRAFT_10037714	F066922	N/A	MSENVRVEDELERLKNVMSQKVQQFASDRTIRRYVARLEKLELGKVTSEQVLRLLAIFLSTPLGQWLAVVVALELLAKYKFFSQISVDVLIGVITASELVQALAKAGIVPEIAGLAGLFG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.