Basic Information | |
---|---|
Taxon OID | 3300000346 Open in IMG/M |
Scaffold ID | BeoS_FeMat_6568CDRAFT_1009880 Open in IMG/M |
Source Dataset Name | Ferric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 902 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Beowulf Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.731451 | Long. (o) | -110.7113131 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070317 | Metagenome / Metatranscriptome | 123 | Y |
F077502 | Metagenome / Metatranscriptome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BeoS_FeMat_6568CDRAFT_10098802 | F070317 | GGTGG | MQTTASNMSVMEELKELNLERIVKDAQEGEVCVVNKILKGKLTDLMPLIRDPATLSQKAMEFIQSRGDDIFYLFQCTTRGGRNVKLLVRQSFDPRSTFYQLMKKYKTIKVGDEVNVFYNPEKRRYDFLL* |
BeoS_FeMat_6568CDRAFT_10098803 | F077502 | GAG | MTDVAHIVIWIEKNLPQEGKLSELIDNVFSLIQEIILNNLSQGKQPISFESVREIADTFKEVIYRSIEQTIGTLTEEVKEQVDAYF |
⦗Top⦘ |