NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GreS_7680CDRAFT_1003795

Scaffold GreS_7680CDRAFT_1003795


Overview

Basic Information
Taxon OID3300000348 Open in IMG/M
Scaffold IDGreS_7680CDRAFT_1003795 Open in IMG/M
Source Dataset NameAcidic sulfate chloride spring microbial streamer communities from Grendel Spring, Yellowstone National Park, USA - T=76-80
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1747
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → Candidatus Nanoarchaeia → Nanoarchaeales → Nanopusillaceae → Candidatus Nanobsidianus → Candidatus Nanobsidianus stetteri(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameGrendel Spring, Yellowstone National park. Wyoming, USA
CoordinatesLat. (o)44.7230812Long. (o)-110.7095749Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090626Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
GreS_7680CDRAFT_10037952F090626GGAMSFSFFHVQNIKFENIYFGRNSLVKLFANKTHLENSTDYDGTALAFLLDVSDFTNTDTLLSHFAIIDGNEIRPILVEWNLRTIHGRLLILLNQVPGPHDTKMLLKRFESMIENQRPETIKYIASQYARALADAKGLHQIYNFLVQRIQQLKSIGIKKSEEEVRRLVEIYR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.