Scaffold GreS_7680CDRAFT_1006374

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GreS_7680CDRAFT_1006374

Scaffold GreS_7680CDRAFT_1006374

Overview

Basic Information
Taxon OID	3300000348 Open in IMG/M
Scaffold ID	GreS_7680CDRAFT_1006374 Open in IMG/M
Source Dataset Name	Acidic sulfate chloride spring microbial streamer communities from Grendel Spring, Yellowstone National Park, USA - T=76-80
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1181
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Acidilobales → Acidilobaceae → Acidilobus → unclassified Acidilobus → Acidilobus sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Grendel Spring, Yellowstone National park. Wyoming, USA
Coordinates	Lat. (^o)	44.7230812	Long. (^o)	-110.7095749	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023054	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
GreS_7680CDRAFT_10063742	F023054	AGGGGG	MEETDELDAQALIDCVALLLFKHGCITDKEAEGLLDLTLEEGMLTAEELQNLILGLEERALSCDDKDVALVAAKLLKEARKEVNNSVKRDLVKVGNR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.