Basic Information | |
---|---|
Taxon OID | 3300000348 Open in IMG/M |
Scaffold ID | GreS_7680CDRAFT_1009976 Open in IMG/M |
Source Dataset Name | Acidic sulfate chloride spring microbial streamer communities from Grendel Spring, Yellowstone National Park, USA - T=76-80 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 825 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Grendel Spring, Yellowstone National park. Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.7230812 | Long. (o) | -110.7095749 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008606 | Metagenome / Metatranscriptome | 330 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GreS_7680CDRAFT_10099761 | F008606 | N/A | AGLAHQLLAQAEVVLVAEARDPEGDPDARSYDKLVELSGQVNELRGQVVSLAERVTRLEEENKWLRQELAEIKGAVTDIRRNSVAILASTITVLVAVVIGLAVH* |
⦗Top⦘ |