Basic Information | |
---|---|
Taxon OID | 3300000356 Open in IMG/M |
Scaffold ID | EM176_1010544 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Cork, Ireland - EM176 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5313 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cork, Ireland | |||||||
Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042910 | Metagenome | 157 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
EM176_10105448 | F042910 | N/A | GGGLHLLRRQREQLSLRVRFLIEEYDIAARHQLLHLVAAWAEAGGVLTLHEDGKRVLRVVCTQYPTMSTLNWLETLSLVFTAFSCPYWEDAAETSFLMPNTSDAPSKLLAVPGDAPETPLNLLIRNIGDAAITTLTISAAGKISFQGLTIAPGAAIRIHHDAGVFAAEMVSDDSTVSILPYRTPDSADDLLLRPGVLNEIRVEASAAAFVSGRCKGRYC* |
⦗Top⦘ |