NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold INPhiseqgaiiFebDRAFT_101503476

Scaffold INPhiseqgaiiFebDRAFT_101503476


Overview

Basic Information
Taxon OID3300000364 Open in IMG/M
Scaffold IDINPhiseqgaiiFebDRAFT_101503476 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1596
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002835Metagenome / Metatranscriptome527Y
F005435Metagenome / Metatranscriptome401Y
F012074Metagenome / Metatranscriptome284Y

Sequences

Protein IDFamilyRBSSequence
INPhiseqgaiiFebDRAFT_1015034762F005435GGAGMSCKSCQSENHYDFNGEIAIHFPGLAGLDKPIVWVFPKLQACLDCDFSEFAIPDTELRQLRENVSD*
INPhiseqgaiiFebDRAFT_1015034764F002835GGAMTMAFPPCLNRWKTLYRAAILETNKSLLPQRVSEAEEAVRARGREIFYGNGTPEEKEALEDALYALRAFRTAWQHSDAT*
INPhiseqgaiiFebDRAFT_1015034765F012074N/AASSHMHAEQTELLAKVNRLTIPVRAFGIGSGVFLLVLVAMLIYQKLNEVQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.