NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SL_9KL_010_SEDDRAFT_10007152

Scaffold SL_9KL_010_SEDDRAFT_10007152


Overview

Basic Information
Taxon OID3300000365 Open in IMG/M
Scaffold IDSL_9KL_010_SEDDRAFT_10007152 Open in IMG/M
Source Dataset NameAlkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 9KL_010_SED
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)7216
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe, Lake Tanatar
CoordinatesLat. (o)51.39Long. (o)79.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071990Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
SL_9KL_010_SEDDRAFT_1000715210F071990GGAGGMAEPTTRFRVIPNDTSADDLNTEAKRLGSISGQTVVSTGEGNEADFGLVDISEGAANSGVLTLLWDVTADGGNTTVETFKFWLAACGFVEADSAIKFRALSGTDNATPSSTENYTANATTESYTFADLDESEPASANLFPTDEGASMVLSTTSDDALMWAMYAAIASGETTGTYKGLDSGYELRFNLKYSYS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.