NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold P_2C_Liq_3_UnCtyDRAFT_100043

Scaffold P_2C_Liq_3_UnCtyDRAFT_100043


Overview

Basic Information
Taxon OID3300000369 Open in IMG/M
Scaffold IDP_2C_Liq_3_UnCtyDRAFT_100043 Open in IMG/M
Source Dataset NameMarine microbial community from Union City, CA, USA - Pond 2C Liquid 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)31732
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameEden Landing Ponds, San Francisco, CA, USA
CoordinatesLat. (o)37.568817Long. (o)-122.10315Alt. (m)Depth (m).11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072835Metagenome / Metatranscriptome121Y
F085330Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
P_2C_Liq_3_UnCtyDRAFT_10004325F085330AGGAGMKTLYEVLNVDLAQEYTKARKLALVKELALEDDLMSEVEAAVEAMDIPTDDDRLHWIEKLGRAAGADLLTLGKVQPENMLAMANLSAEDFQAAVKVATNSARSWNQLTVSAEKDLNAETIPSTMV*
P_2C_Liq_3_UnCtyDRAFT_10004326F072835AGGAMALPPTGSTISMSDIRNYFVSGGQASSYTISVLGTYIGISAGSVISMSSSFGGYYFPILP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.