NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CisS_allDRAFT_1009062

Scaffold CisS_allDRAFT_1009062


Overview

Basic Information
Taxon OID3300000398 Open in IMG/M
Scaffold IDCisS_allDRAFT_1009062 Open in IMG/M
Source Dataset NameHypoxic/sulfidic aquatic microbial communities from Cistern Spring, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1201
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park, Wyoming
CoordinatesLat. (o)44.7230812Long. (o)-110.7040247Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058287Metagenome135N

Sequences

Protein IDFamilyRBSSequence
CisS_allDRAFT_10090622F058287N/AMSSTKSYFESIDKVCLQIKYLRTLFLESRIEPIRALSGSLLLKSIYIIINLITELVLGEVPPVNKDISEIELSKIKEPRKIFDDVCWLIVNMFKLASITQDKQKRYKLLLLLNKVENIFIDLVHSTVFNEDIDYDRVDEELTKIKDELQKIIKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.