Scaffold CisS_allDRAFT_1016278

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CisS_allDRAFT_1016278

Scaffold CisS_allDRAFT_1016278

Overview

Basic Information
Taxon OID	3300000398 Open in IMG/M
Scaffold ID	CisS_allDRAFT_1016278 Open in IMG/M
Source Dataset Name	Hypoxic/sulfidic aquatic microbial communities from Cistern Spring, Yellowstone National Park, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	684
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park, Wyoming
Coordinates	Lat. (^o)	44.7230812	Long. (^o)	-110.7040247	Alt. (m)		Depth (m)	9
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105516	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
CisS_allDRAFT_10162782	F105516	AGG	MPKAVVRVLALGRVSLNFKTFRVIENERLSIASDGTVNCLGAGCSANGVFITLEADRPNARELFEVLRRVRVLEFEVEIHGLPNWLLSRLEFLVGEPISRDAKVKYTWRSMPSFEELALVLNDLNTN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.