NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ZC3D78_104610

Scaffold ZC3D78_104610


Overview

Basic Information
Taxon OID3300000476 Open in IMG/M
Scaffold IDZC3D78_104610 Open in IMG/M
Source Dataset NameZC3D78
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Sao Paulo
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1224
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo Park
CoordinatesLat. (o)-23.651079Long. (o)-46.620668Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059782Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
ZC3D78_1046103F059782GGAGMRVEFQVARGRMIRGKGSQVAAFSVLLDIDSEHLDVLERADIAQRLITRFAQAIAEEFGGQEIDIRRPRE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.