Scaffold AAW_1002191

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AAW_1002191

Scaffold AAW_1002191

Overview

Basic Information
Taxon OID	3300000494 Open in IMG/M
Scaffold ID	AAW_1002191 Open in IMG/M
Source Dataset Name	Anaerobic digester microbial communities from Northern Denmark, sample from West Aalborg sludge
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2895
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location Name	Soeholt, Denmark
Coordinates	Lat. (^o)	57.045078	Long. (^o)	10.047414	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
AAW_10021913	F010244	N/A	MTYKVKFTHSDKSRAHINCAELREGEVIYKHPRGRFVVLEFQGESGKFREAFWPEEIVKAI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.