NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AAW_1003161

Scaffold AAW_1003161


Overview

Basic Information
Taxon OID3300000494 Open in IMG/M
Scaffold IDAAW_1003161 Open in IMG/M
Source Dataset NameAnaerobic digester microbial communities from Northern Denmark, sample from West Aalborg sludge
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAalborg University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1441
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location NameSoeholt, Denmark
CoordinatesLat. (o)57.045078Long. (o)10.047414Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033394Metagenome / Metatranscriptome177N

Sequences

Protein IDFamilyRBSSequence
AAW_10031612F033394N/AMKSIYIYFVDEKADIYYKDNSKNLHCTINLYTTNKEIREQFRKNLLKRYWDRLEINDIDDLKMIVKDSFVQIFTLQREKIDKND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.