Scaffold LJNas_1000596

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LJNas_1000596

Scaffold LJNas_1000596

Overview

Basic Information
Taxon OID	3300000546 Open in IMG/M
Scaffold ID	LJNas_1000596 Open in IMG/M
Source Dataset Name	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI), Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6195
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain

Source Dataset Sampling Location
Location Name	Sierra Nevada National Park, Granada, Spain
Coordinates	Lat. (^o)	36.96971	Long. (^o)	-3.46027	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017683	Metagenome / Metatranscriptome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
LJNas_10005964	F017683	N/A	MARYLEEPKYRSDAMNLLKWLLGQGCQHRFTWPRIDVTGNHYQICLLCGTAYEYDWATMRRTERPLTVDVRHA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.