Scaffold TBL_comb47_HYPODRAFT_10061700

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TBL_comb47_HYPODRAFT_10061700

Scaffold TBL_comb47_HYPODRAFT_10061700

Overview

Basic Information
Taxon OID	3300000553 Open in IMG/M
Scaffold ID	TBL_comb47_HYPODRAFT_10061700 Open in IMG/M
Source Dataset Name	Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	2157
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.041	Long. (^o)	-89.686	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071905	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
TBL_comb47_HYPODRAFT_100617004	F071905	AGGAGG	MAKSLKLWENKDWVYKRYVVEKKSVLDMAMEAKCSHMTIQRALERFDLIKKPRKWTKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.