NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AP72_2010_repI_A1DRAFT_1014753

Scaffold AP72_2010_repI_A1DRAFT_1014753


Overview

Basic Information
Taxon OID3300000650 Open in IMG/M
Scaffold IDAP72_2010_repI_A1DRAFT_1014753 Open in IMG/M
Source Dataset NameForest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location NameAmazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
CoordinatesLat. (o)-10.171667Long. (o)-62.7875Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087156Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
AP72_2010_repI_A1DRAFT_10147531F087156N/AEHGWAKDQAAILYREALELIPEGDSVQLADLRRRLAMARAASYHIPDAQQLIQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.