NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AF_2010_repII_A100DRAFT_1034461

Scaffold AF_2010_repII_A100DRAFT_1034461


Overview

Basic Information
Taxon OID3300000655 Open in IMG/M
Scaffold IDAF_2010_repII_A100DRAFT_1034461 Open in IMG/M
Source Dataset NameForest soil microbial communities from Amazon forest - 2010 replicate II A100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)927
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location NameAmazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
CoordinatesLat. (o)-10.171667Long. (o)-62.7875Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086095Metagenome / Metatranscriptome111Y
F088458Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
AF_2010_repII_A100DRAFT_10344611F088458GAGMRVSEITALAFLAITVAGFSTRVGSAQTPDLECAQLSNVPDDGTPLAVGLKVLASKKIDPSQAESACRSALRADPANPTFMFLLGRALSLGNKRLEAIKYYLDAVDRGHAGAMNDLG
AF_2010_repII_A100DRAFT_10344612F086095N/AMPITLLEIKTAFGPEDTAAMTAAFEEALKRLNVADREAPIAISVAKKIVRLAKKGECNPTRLTDGVIS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.