Scaffold JGI12421J11937_10118465

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12421J11937_10118465

Scaffold JGI12421J11937_10118465

Overview

Basic Information
Taxon OID	3300000756 Open in IMG/M
Scaffold ID	JGI12421J11937_10118465 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	695
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location Name	Lake Erie, Canada
Coordinates	Lat. (^o)	41.77	Long. (^o)	-81.73	Alt. (m)		Depth (m)	20
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084135	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12421J11937_101184651	F084135	N/A	KIYILMHKENNFQSESKRSGDAFEELVYTDLVNRGFGSIDRNYCFEGAGCEVDFRAHSDKHTEYVEAKGGIAGEGKRPGAQRTDNVKKAIANGALIKTYNTIYYVVYFSAKPEPGSYSDNMIKTALKSKIIDEVRYLEPVNKFKQYWLDFDNEF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.