NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AF_2010_repII_A001DRAFT_10002126

Scaffold AF_2010_repII_A001DRAFT_10002126


Overview

Basic Information
Taxon OID3300000793 Open in IMG/M
Scaffold IDAF_2010_repII_A001DRAFT_10002126 Open in IMG/M
Source Dataset NameForest soil microbial communities from Amazon forest - 2010 replicate II A001
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4374
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location NameAmazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
CoordinatesLat. (o)-10.171667Long. (o)-62.7875Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049140Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
AF_2010_repII_A001DRAFT_100021268F049140N/AMIEVATTTHHHRLLYALVAAAGVGLGLALIAFCDAWFSGSGFSGVQFIGAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.