Basic Information | |
---|---|
Taxon OID | 3300000831 Open in IMG/M |
Scaffold ID | JGI12271J12027_1100281 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate B) D5B (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 945 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Moab, Utah | |||||||
Coordinates | Lat. (o) | 38.714694 | Long. (o) | -109.692944 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001042 | Metagenome / Metatranscriptome | 794 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12271J12027_11002812 | F001042 | AGGCGG | MTTSHLIGGNEALDVPKDFEADTDDKIVIDKLLVNKLTELLINSIYSVHVSRRSEIFLTSLDMHLADFSISNKNDIVCREFTEKSSLLLESYQKDVPKSLGKAESCL |
⦗Top⦘ |