NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12273J12029_10015990

Scaffold JGI12273J12029_10015990


Overview

Basic Information
Taxon OID3300000833 Open in IMG/M
Scaffold IDJGI12273J12029_10015990 Open in IMG/M
Source Dataset NameSoil microbial communities from Moab, Utah, sample - Soil Crust Prior wet up (biological replicate C) 0C (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2612
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameMoab, Utah
CoordinatesLat. (o)38.714694Long. (o)-109.692944Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005661Metagenome / Metatranscriptome393Y
F058553Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
JGI12273J12029_100159902F058553AGGAGMAQTRAVLPSRFVPLADELLAATGASDYSTLIGILLSRYGKHLLNTWEIANCPQVAAVQQPIADMSVEQPETFTPMEF*
JGI12273J12029_100159904F005661AGCAGMMQNFRVAQTPGAAHIKRQFNYHSGPLTPEMVNEAGKEAKILDLQKQLRTAYNRHDAKIRANTVEIERLTLEAQENGLTDTLQIDKYVAKAIAAGAKYDQNIINLQQKLQQELGLIKVESASTQTLQNADFRQRLLLIKANHTAKGQIQQNGFQQSLKAIQASPQQAIAMQAKRSAFNNYINAKDFDPIPAVSGGSGGGNSPIVSNNSKGFLGGLFDFFSGRK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.