Scaffold JGI10213J12805_10242489

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI10213J12805_10242489

Scaffold JGI10213J12805_10242489

Overview

Basic Information
Taxon OID	3300000858 Open in IMG/M
Scaffold ID	JGI10213J12805_10242489 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	598
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Wisconsin, USA
Coordinates	Lat. (^o)	43.312222	Long. (^o)	-89.370833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024189	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10213J12805_102424891	F024189	GGAG	MPITPFLAGGRFDRETIRIMGVAFEMACVALRLANRDDDANEIIARRIIELAKSGERNPYLLCENVLKEFREQRP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.