Scaffold EsTDRAFT_1024754

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold EsTDRAFT_1024754

Scaffold EsTDRAFT_1024754

Overview

Basic Information
Taxon OID	3300000867 Open in IMG/M
Scaffold ID	EsTDRAFT_1024754 Open in IMG/M
Source Dataset Name	Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1774
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River estuary
Coordinates	Lat. (^o)	46.235	Long. (^o)	-123.91	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083722	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
EsTDRAFT_10247543	F083722	N/A	MKKILFLLFVLFSVKTNAQSITLILNDPDKQSPTNVRVKPGGEVITTIDSRAELATVHVIAKEGNYFLVNSYSTCSSDEMQLKQPGYIHYSVLGIFISNYANIAIPVYASSNKSGPLEKLKISDVFVNVLDYKNDMYYVFYKKLNKKFWVESKYLCNAACTTCN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.