NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FwDRAFT_10034964

Scaffold FwDRAFT_10034964


Overview

Basic Information
Taxon OID3300000882 Open in IMG/M
Scaffold IDFwDRAFT_10034964 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Columbia River
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7982
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (64.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River freshwater tidal region
CoordinatesLat. (o)46.18Long. (o)-123.18Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001229Metagenome / Metatranscriptome741Y
F006841Metagenome / Metatranscriptome363Y

Sequences

Protein IDFamilyRBSSequence
FwDRAFT_1003496412F006841AGGAGGLATTVYSVEEITLQNGATVKLKPLSIKELRKFMIAVQRTADVTTEDETLDILIDACAVALEKQLPDLVADRDLLEDALDVPTINRILEVCGGIKLDDPNQLAAMVLAGQN*
FwDRAFT_100349647F001229N/AMNDLIGSLLSMKVDVYRQIDKQDPNTGAIKKEWIFFKTVNCHAKGVISNSATARGSDSQTFSNKYKNEQIVQIRTWDRLTTREKITNIRDSENNVIWKELNFPSDSPTVFEVIGTTPITDPFGKTMGFNSSVMRSENQQIGL*
FwDRAFT_100349649F000258GGAGGMTTDYKLDATLEIRKYLWDQILTIGILEENDYYSDNVGEAIVPIIPVQQSPELNQFLSGKSHIVYDKIGMSYEDNWAICCEQVLFTIYSTDVSEINQIRNFMTDLFRRMDGSAKDLNLWSGVSDKFKFYSIFISEISPTAPSEELQGFLSADVVLEIKYSRISDTNGRFI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.