Scaffold FwDRAFT_10067571

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FwDRAFT_10067571

Scaffold FwDRAFT_10067571

Overview

Basic Information
Taxon OID	3300000882 Open in IMG/M
Scaffold ID	FwDRAFT_10067571 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from the Columbia River
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1860
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River freshwater tidal region
Coordinates	Lat. (^o)	46.18	Long. (^o)	-123.18	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039639	Metagenome / Metatranscriptome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
FwDRAFT_100675715	F039639	GGAGG	MNIDREFVKWFYEEHYPEQGSNRRQVYSTTQNSQNINVIDYWMREAFKAGAEAATYGYEVNALEQFEAFNINRNYPL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.