NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11643J12802_11058824

Scaffold JGI11643J12802_11058824


Overview

Basic Information
Taxon OID3300000890 Open in IMG/M
Scaffold IDJGI11643J12802_11058824 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2347
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015492Metagenome / Metatranscriptome254Y
F029488Metagenome / Metatranscriptome188N

Sequences

Protein IDFamilyRBSSequence
JGI11643J12802_110588241F029488N/ALLAGCAGYSPECVTGTGTKGCAPGTMGHQQMTQEQQGEETVASIDDARCRAHAAPGSSEYLACRQRAAKSRGSGR*
JGI11643J12802_110588243F015492N/AGEVMSMKRQVSIYVAAMLALIYAGLQSGARAQVFDFGQIEEFESLGSGTQKGGSPPKTIIDDGARHTVLFTILESNTEAKIYWKSKDGSQTTIMRGQGLRAFQTVGEFRIEAVGDDSRSFRYGYVLFRLKSEKSAQEDKI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.